PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_4792.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 1002aa    MW: 110231 Da    PI: 7.4034
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_4792.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1308.6e-4162139178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cqv++C+adl++ak+yhrrhkvCe+hsk+++++v++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  MLOC_4792.2  62 MCQVDDCRADLTSAKDYHRRHKVCEIHSKTTKAVVANQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 139
                  6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-3456124IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.09460137IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.89E-3861140IPR004333Transcription factor, SBP-box
PfamPF031109.6E-3063136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1002 aa     Download sequence    Send to blast
MAMDVSPTTT MSSSPSPPAR TSQEQAARPS KRVRSGSPGT ASGGGGGGGA GGSASGGGSY  60
PMCQVDDCRA DLTSAKDYHR RHKVCEIHSK TTKAVVANQM QRFCQQCSRF HPLSEFDEGK  120
RSCRRRLAGH NRRRRKTQPT DVASQLLLPE NQENTANRTQ DIVNLITVIA RLQGGNVGKL  180
PSIPPIPDKD NLVQIISKIN SINNANSLGK SPPSEAIDLN ASHGQQQDSP VQNATKVVDK  240
QTVPSTMDLL TVLSGALGTS TPETNTSQSQ GSSDSSGNNK SKSHSTEPAC VVNSHEKSIR  300
PFPAAGVIRS NSTHGSPPEI YKQPDRDTHP YLSLQLFGNA EVDIPVKMDT ANKYLSSESS  360
NPMDERSPSS SPPVTRTFFP TRSVNEGIRH PRIADYGEDA ATAEISTTRA WCAPQLELFK  420
DSERPTENGS PPNPTYQSCY ASTSGSDHSP STSNSDGQDR TGKIIFKLFG KEPGSIPGNL  480
RDEVVNWLKH SPTEMEGYIR PGCLVLSMYL SMPTIAWDEL EENFLQRVNS LVQASDLDFW  540
RKGRFLVRSD NQLVSYKDGM TRLSKSWRTW NTPELTLVTP IAVVGGRKTS LVLKGRNLTI  600
PGTQIHCTSG GKYISKEVLC SAYPGTIYDD SGVETFDLPG EPNLTLGRCF IEVENRFRGN  660
SFPVIFASKS ICHELRNLEA ELEDSRFPDV SSDDQVHDAR RLKPRDQVLH FLNELGWLFQ  720
KAAACTPSIE SDVSDSELIQ FSTARFRHLL LFSNERDWCS LTKTLLEVLS KRSLVSEELS  780
QETLEMLSEI HLLNRAVKRK SSHMVHLLVQ FVVICPDNSK LYPFLPNYPG PGGLTPLHLA  840
ASIDDAEDIV DALTDDPQQI GLSCWHSVLD DEGISPEVYA KFRNNGSYNE LVARKLVDRK  900
NSQVTIVLNK GEIHMDQPEN AGANNSSGIQ ALEIRSCSQC AILESGLLRR PMRSRGLLAR  960
PYIHSMLAIA AVCVCVCVFM RALLRFNSGR TFKWERLDFG PT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-3254136284squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00664PBMTransfer from Potri.002G002400Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3744540.0AK374454.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3065A01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574766.10.0PREDICTED: squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
TrEMBLM0WBU80.0M0WBU8_HORVD; Uncharacterized protein
STRINGMLOC_4792.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76580.10.0SBP family protein